prokka
prokka copied to clipboard
tseemann
:zap: :aquarius: Rapid prokaryotic genome annotation
Hello Prokka team, I have been using Prokka with a default setting for annotating E. coli genomes. I noticed that the identified virulence factor genes are different between ABRicate (VFDB)...
Hello, COG number has been included in my gbk file (db_xref="COG:COG2211"), now I want to get its corresponding classification, as shown in the picture below:  Is that possible? What...
Hello, I used prokka to annotate draft asssemblies followed by Roary for presence/absence matrix. Interestingly, I find the same gene sometimes or same gene_number (geneX_1,geneX_2) with different abundancies! One time...
Yo! Here is a PR to convert the Travis Ci tests to Github Actions PLease squash and merge!
Dear @tseemann, I have spotted what I think could be a small bug in the output `.gbk` file from Prokka. I noticed the contig names were not matching those of...
Is there a way to obtain a GFF file that does not annotate the sequence of "product=hypothetical protein"
Hi sicentists, I'm trying to annotate metagenomic assemblies which were directly assembled through Megahit. I have a big fasta file (318MB) which containing 64096 contigs. After Prokka annotation, I noted...
In the *.gbk file and perhaps others, the output file does not have a space between the Locus designation and the length, causing errors when other programs attempto to read...
Dear Developer, I am trying prokka for viral genome annotation. I got my assembled contigs from spade assembler. When I tried prokka, I got the following warning. Have attached my...
Prokka gives me different gene names "abaI" and "anoI" for the same sequence /gene="abaI" /locus_tag="EANKAABD_00114" /EC_number="2.3.1.184" /inference="ab initio prediction:Prodigal:002006" /inference="similar to AA sequence:UniProtKB:B0FLN1" /codon_start=1 /transl_table=11 /product="Acyl-homoserine-lactone synthase" /translation="MNIIAGFQNNFSEGLYTKFKSYRYRVFVEYLGWELNCPNNEELD QFDKVDTAYVVAQDRESNIIGCARLLPTTQPYLLGEIFPQLLNGMPIPCSPEIWELSR FSAVDFSNPPSSNSQAVSSPVSIAILQEAINFAREQGAKQLITTSPLGVERLLRAAGF...
