rubenbucio

I have the same issue... A short sequence is a fragment of a longer one, but they do not cluster together in a db of 95M proteins. > EAM_TARA_034SRF_c20347||rbs:common_1 MILTDLICFCKDKCVCTYTWQLKAQEAAAVDEPKVHNFKDSNVVGAKGEEVIIPLLQNKY...

Hi! This is the kind of output I have 2021-04-05 15:39:34.824010: I tensorflow/compiler/jit/xla_cpu_device.cc:41] Not creating XLA devices, tf_xla_enable_xla_devices not set 2021-04-05 15:39:34.825857: I tensorflow/core/platform/cpu_feature_guard.cc:142] This TensorFlow binary is optimized with...

Did you find any way to make it work?? I'm stuck with "--target-cov"