paritytech-cicd-pr

Results 322 comments of paritytech-cicd-pr

## 🦑 📈 ink! Example Contracts ‒ Changes Report 📉 🦑 These are the results when building the `examples/*` contracts from this branch with `cargo-contract 1.5.0-792e4f3` and comparing them to...

## 🦑 📈 ink! Example Contracts ‒ Changes Report 📉 🦑 These are the results when building the `examples/*` contracts from this branch with `cargo-contract 1.4.0-25bfb96` and comparing them to...

## 🦑 📈 ink! Example Contracts ‒ Changes Report 📉 🦑 These are the results when building the `examples/*` contracts from this branch with `cargo-contract 1.5.0-ef06f4d` and comparing them to...

## CRITERION BENCHMARKS ## |BENCHMARK|MASTER|PR|Diff| |---|---|---|---| | `compile_and_validate_v1` | 5.4826 ms | 6.9725 ms | :red_circle: +27.222% | | `execute_count_until_v1` | 2.0229 ms | 1.4791 ms | :green_circle: -26.874% |...

The CI pipeline was cancelled due to failure one of the required jobs. The job name - cargo-check-benches The job logs - https://gitlab.parity.io/parity/mirrors/substrate/-/jobs/1969865

## BENCHMARKS ## NATIVEWASMTIME BENCHMARKMASTERPRDIFFMASTERPRDIFFWASMTIME OVERHEAD execute/bare_call_0 1.23ms 1.20ms :green_circle: -1.98% 902.71µs 908.39µs :red_circle: 0.65% :green_circle: -25%execute/bare_call_0/typed 652.44µs 651.51µs :white_circle: 0.02% 389.28µs 408.21µs :red_circle: 4.85% :green_circle: -37%execute/bare_call_1 1.33ms 1.32ms :green_circle:...

## BENCHMARKS ## NATIVEWASMTIME BENCHMARKMASTERPRDIFFMASTERPRDIFFWASMTIME OVERHEAD execute/bare_call_0 1.27ms 1.27ms :white_circle: 0.43% 1.12ms 1.09ms :green_circle: -2.98% :green_circle: -14%execute/bare_call_0/typed 698.58µs 705.30µs :white_circle: 0.90% 547.87µs 551.10µs :white_circle: 0.60% :green_circle: -22%execute/bare_call_1 1.40ms 1.40ms :green_circle:...

## BENCHMARKS ## NATIVEWASMTIME BENCHMARKMASTERPRDIFFMASTERPRDIFFWASMTIME OVERHEAD execute/count_until 888.50µs 1.24ms :red_circle: 40.06% 2.38ms 3.10ms :red_circle: 30.07% :red_circle: 149%execute/factorial_iterative 400.45ns 542.71ns :red_circle: 35.46% 993.53ns 1.30µs :red_circle: 30.67% :red_circle: 139%execute/factorial_recursive 761.07ns 840.76ns :red_circle:...

## BENCHMARKS ## NATIVEWASMTIME BENCHMARKMASTERPRDIFFMASTERPRDIFFWASMTIME OVERHEAD execute/bare_call_0 1.28ms 1.27ms :white_circle: -2.43% 1.10ms 1.10ms :white_circle: -0.17% :green_circle: -13%execute/bare_call_0/typed 699.74µs 698.36µs :white_circle: -0.29% 543.08µs 546.59µs :white_circle: 0.88% :green_circle: -22%execute/bare_call_1 1.40ms 1.40ms :white_circle:...

## BENCHMARKS ## NATIVEWASMTIME BENCHMARKMASTERPRDIFFMASTERPRDIFFWASMTIME OVERHEAD execute/bare_call_0 1.29ms 1.32ms :red_circle: 1.96% 1.12ms 1.10ms :red_circle: -1.89% :green_circle: -17%execute/bare_call_0/typed 703.72µs 754.52µs :red_circle: 7.16% 537.68µs 544.35µs :red_circle: 1.19% :green_circle: -28%execute/bare_call_1 1.40ms 1.44ms :red_circle:...