hima111997

i tried to update to the last stable version but gave the same error when I tried to run the QH entropy

i updated it but produced the same error input file: [mmpbsa.in.log](https://github.com/Valdes-Tresanco-MS/gmx_MMPBSA/files/9092209/mmpbsa.in.log) index file: [index.ndx.log](https://github.com/Valdes-Tresanco-MS/gmx_MMPBSA/files/9092219/index.ndx.log) topology file + parameters: [gromacs.top.log](https://github.com/Valdes-Tresanco-MS/gmx_MMPBSA/files/9092220/gromacs.top.log) pdb file: [gromacs.pdb.log](https://github.com/Valdes-Tresanco-MS/gmx_MMPBSA/files/9092221/gromacs.pdb.log) first 10 frames: [10frames.xtc.log](https://github.com/Valdes-Tresanco-MS/gmx_MMPBSA/files/9092270/10frames.xtc.log)

Thank you for your help. I checked the notebook. Just to be sure, my case include a homo tetramer with the same loop missing in each copy. So should I...

i have done as mentioned in the instructions, however it produced an error related to the pdb file. ``` --------------------------------------------------------------------------- FileNotFoundError Traceback (most recent call last) [](https://localhost:8080/#) in () 174...

the error was solved by doing this !cp tetramer.pdb tmp/AF-tetramer-F1-model_v4.pdb i copied and renamed my pdb file to the tmp folder. However, now after running the cell, while setting copies...

this is the template features and the propagate_to_copies selection was not selected: 

yes. i ran the cells again but gave me the same plot: 

this worked fine when i removed the renumber option. However there is a new bug. when I add a sequence in the heavy and light chain with the renumber option...

EVKLQESEREQTTNGAWLNVKAYPHISSSKATLPKPSRTAPPTGDQMSKHLSLVFSSTYCDIQGFSQSVFRPGPICVVCVQSWSYLCTVCPILVLSVYVFSPGPICVHVCPVLVPSVYPLVPGGGGSGGGGSGGGGSDIVLTQSPWMVDVSNKFTVKYKTRGHYDPETLSQPEPAALVTLNCPFPGAHSSQPRTPVFASLSGLKSKPHLFLDSAHQPSANIPVTVPLLMHILPGSWDAAPTV