How to turn off "translation" for amino acid seqs?

[rtviii]

I unfortunately get this "translation" annotation at the bottom of the sequence, which i don't see how i would ve enabled.

It's pretty annoying because i can't select ranges of residues (the moment you clikc on one the whole sequence gets selected via this blue translation flyer). I was looking forward to using the 'linear' version of the viz...

Just installed the packaged and tried the simple example:

import { SeqViz } from "seqviz"
...
  <SeqViz
    name="J23100"
    seq="MEQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR"
    // annotations={[{ name: "promoter", start: 0, end: 34, direction: 1, color: "blue" }]}
  />