progen icon indicating copy to clipboard operation
progen copied to clipboard

Published 20 hours ago • verified publisher icon salesforce

Generate sequence based on natural one

Open avivlazar opened this issue 2 years ago • 3 comments

Hi, First of all, thank you for sharing ProGen2 code. I read the article as part of my thesis, and started playing with the model.

My questions:

  1. How may I generate a new sequence by ProGen2 which based on natural sequence? For example: Natural seq: "DQSVRKLVRKLPDEGLDREKVKTYLDKLGVDREELQKFSDAIGLESSGGS" A new generated seq: "GSSDIEITVEGKEQADKVIEEMKRRNLEVHVEEHNGQYIDKASLESSGGS"

  2. In generation process, is it possible to define which station/s in natural sequence I want ProGen2 will change? if yes - how? Example: I want to change only the 3rd station in sequence, so: Natural seq: "DQSV..." Possible generated sequence: "DQGV..." So the 3rd station "S" was changed to "G".

Best Regards, Aviv.

avivlazar avatar Feb 04 '23 14:02 avivlazar

Hello, they are also currently my questions. Have you solved these problems?

Dongchengzhi avatar Feb 13 '23 15:02 Dongchengzhi

I also have these questions.

xubocheng avatar Feb 28 '23 02:02 xubocheng

Hello, they are also currently my questions. Have you solved these problems?

Solstice-Pan avatar Jan 31 '24 07:01 Solstice-Pan