Unusual behavior for Chain as the input sequence gets modified when providing the output

[ahmadpgh]

Hi,

Running the snippet below, I expected to see a similar chain.seq to the input sequence but it seems the order of amino acids is modified. Specifically GSEHR is replaced by RHESG. May I ask why we see this change?

from abnumber import Chain

seq = "AVQLVDSGGGTLQAGKSLRLSCAISGLAFDGGAMGSEHRLTAGAMGWFRQAPGKDREFVAAISPRTDETYYAESLEGRFSVSRDAAATMVFLQADNVRLDDTASYYCAADEDVTPRVMGVIPHADHWGQGTLVTVSS"
chain = Chain(seq, scheme='imgt')
print("Sequence:\n", seq)
print("Chain:\n", chain)
assert chain.seq==seq

Thanks for your reply in advance