camel2000

Results 17 comments of camel2000

localcolabfold raise error "malloc(): invalid size (unsorted)" during expandaln

@milot-mirdita thanks, this is the query fasta content ``` >tr|A7TBS3|A7TBS3_NEMVE Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g153959 PE=4 SV=1 Split=0 VCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSATNYVWML ```

localcolabfold raise error "malloc(): invalid size (unsorted)" during expandaln

you known what，I succeeded on the uniref30_2302 dataset， but failed many many times on colabfold_envdb_202108 （GPU version） @milot-mirdita

localcolabfold raise error "malloc(): invalid size (unsorted)" during expandaln

i am trying to （i restart over again）. when i have something new ，i will let you known @milot-mirdita thanks very much

localcolabfold raise error "malloc(): invalid size (unsorted)" during expandaln

@milot-mirdita i think i have solved all the bugs，the failure on the colabfolddb is because “there have no enough apace on /tmp ”, There is only one line of information...

when I use GPU to accelarate colabfold_search , it slower than colabfold_search by using cpu

how about you just use one GPU instead 4 （export CUDA_VISIBLE_DEVICES=0）

when I use GPU to accelarate colabfold_search , it slower than colabfold_search by using cpu

can i see the pipeline you are using？

when I use GPU to accelarate colabfold_search , it slower than colabfold_search by using cpu

for example， this is my cpu version pipeline mkdir -p ${result_dir} mmseqs createdb ${input_fasta_path} ${result_dir}/qdb mmseqs search ${result_dir}/qdb ${database_path} \ ${result_dir}/res ${result_dir}/tmp \ --num-iterations 3 --db-load-mode 2 -s 8 -e...