SubcellularLocalization Dataset error

[chrismun]

".../protein.py", line 301, in from_sequence raise ValueError("Invalid sequence %s" % sequence) ValueError: Invalid sequence MALAVRVVYCGAUGYKPKYLQLKEKLEHEFPGCLDICGEGTPQVTGFFEVTVAGKLVHSKKRGDGYVDTESKFRKLVTAIKAALAQCQ

Error loading the SubcellularLocalization dataset, I get a similar error with the BinaryLocalization dataset, however other datasets, such as Stability, work for me.

[beyzoskaya]

The problem is because of the invalid amino acid types occur inside the protein seqeunces I guess. While creation of Protein data object, it is not handled. I added skip block for the unknown aa's inside the protein sequences.