BALM icon indicating copy to clipboard operation
BALM copied to clipboard

Inference code for Bio-Inspired Antibody Language Model

Bio-Inspired Antibody Language Model (BALM)

This repository contains inference code for Accurate Prediction of Antibody Function and Structure Using Bio-Inspired Antibody Language Model arch-BALMFold

Create Environment

conda env create -f environment.yml
conda activate BALM

Preparation

The pre-trained weights of BALM can be downloaded from Google Drive link: pretrained-BALM

Run inference

from modeling_balm import BALMForMaskedLM
from ba_position_embedding import get_anarci_pos
from transformers import EsmTokenizer
import torch

# an antibody sequence example
input_seq = "AVQLQESGGGLVQAGGSLRLSCTVSARTSSSHDMGWFRQAPGKEREFVAAISWSGGTTNYVDSVKGRFDISKDNAKNAVYLQMNSLKPEDTAVYYCAAKWRPLRYSDNPSNSDYNYWGQGTQVTVSS"

tokenizer = EsmTokenizer.from_pretrained("./tokenizer/vocab.txt", do_lower_case=False, model_max_length=168)

tokenizer_input = tokenizer(input_seq, truncation=True, padding="max_length", return_tensors="pt")
# generate position_ids
tokenizer_input.update(get_anarci_pos(input_seq))

with torch.no_grad():
    # please download from Google drive link before
    model = BALMForMaskedLM.from_pretrained("./pretrained-BALM/")
    # on CPU device
    outputs = model(**tokenizer_input, return_dict=True, output_hidden_states=True, output_attentions=True)

    # final hidden layer representation [batch_sz * max_length * hidden_size]
    final_hidden_layer = outputs.hidden_states[-1]
    
    # final hidden layer sequence representation [batch_sz * hidden_size]
    final_seq_embedding = final_hidden_layer[:, 0, :]
    
    # final layer attention map [batch_sz * num_head * max_length * max_length]
    final_attention_map = outputs.attentions[-1]

BALMFold server

BALMFold is based on BALM to predict antibody tertiary structure with primary sequence. The online server is freely available at BALMFold server. Just try it. :)

Citation

If you find our model is useful for you, please cite as:

@article{jing2024accurate,
  title={Accurate prediction of antibody function and structure using bio-inspired antibody language model},
  author={Jing, Hongtai and Gao, Zhengtao and Xu, Sheng and Shen, Tao and Peng, Zhangzhi and He, Shwai and You, Tao and Ye, Shuang and Lin, Wei and Sun, Siqi},
  journal={Briefings in Bioinformatics},
  volume={25},
  number={4},
  pages={bbae245},
  year={2024},
  publisher={Oxford University Press}
}

The architecture and pre-training process of BALM builds on the ESM and Hugging Face modeling framework. We really appreciate the work of ESM and Hugging Face team.

License

This source code is licensed under the MIT license found in the LICENSE file in the root directory of this source tree.