'Namespace' object has no attribute 'hbm'

[Sxxnwei]

Hi Arkadiy,

I am trying to use FeGenie to identify proteins involved in iron reduction.

My inputs are two amino acid fasta files from two metatranscritptome data. they are significant genes estimated by edgeR.
I ran the command: (fegenie) sxxn@Seans-MacBook-Pro ~ % FeGenie.py -bin_dir /Volumes/SEAN/edgeR_DEG/ --orfs --skip -bin_ext fasta -out fegenie_out

then i got this: Ok, proceeding with analysis! All required arguments provided!

Traceback (most recent call last): File "/Users/sxxn/miniconda3/envs/fegenie/bin/FeGenie.py", line 3020, in main() File "/Users/sxxn/miniconda3/envs/fegenie/bin/FeGenie.py", line 2744, in main if args.hbm: ^^^^^^^^ AttributeError: 'Namespace' object has no attribute 'hbm'

and here is my input fasta:

4085_2 MRLTTKGRFAVTAMIDVALRQHAGPVTLAGIAERQKISLSYLEQLFGKLRRNQLVASTRGPGGGYTLAKPLAAVSVADIISAVDEPLDATSCGGRGNCHDDHPCMTHDLWMSLNARMHEYLSSVNLDHLVRQQGIKGCANEAQPVTIGKAPARRIPVMATA* 7_1 MKVTKIFTHGLLWVIIVMLVIPPGIMAQDTEETVQSAQFNEEELAQMLAPIALYPDSLIAEILMASTYPIEVVEAER 9_1 MKGMKIYIKGLSWVIIVMLMMPPGLMAQDSGQIEQPVKFNKEELAQMLAPIALYPDSLIAQILMASTYPIEVVEAERWIRKNKNLTGDELDSALQEKTWDPSVKSLCHFPDILYAMSEKLDQTTKLGDAFLSQQDEVMDTIQELRRKAQEQGNLTTTKEQKVIVEQETIYIEPANPEIIYVPAYDPLYVYGPWWYPAYP

Any idea I can fix this error?

Thanks, Sean

[Arkadiy-Garber]

Hi Sean,

Thanks for your interest in FeGenie! I am having trouble reconciling the error with the current version of FeGenie that's currently on GitHub. When did you install this software? In any case, could you please try re-installing it and trying to run the program again. Looking at the error message, it looks like an older version of the software.

Thanks! Arkadiy